Buy Cagrilintide Peptide Ireland
Buy Cagrilintide Peptide in Ireland as a research-grade peptide available in 5mg and 10mg options. Cagrilintide is a long-acting, lipidated analogue of the peptide hormone amylin and has been investigated in laboratory and clinical research involving amylin receptor signalling, appetite-related pathways, metabolism and body-weight regulation. It is supplied by Research Peptides Ireland strictly for laboratory and scientific research, not for human or veterinary use.
What Is Cagrilintide?
Cagrilintide is a synthetic, long-acting amylin analogue developed for research into metabolic and amylin-receptor biology. It is also known by development codes including AM833 and NN9838. Unlike a simple short peptide, cagrilintide contains a lipid modification that contributes to its extended biological characteristics.
Cagrilintide has been investigated both as a standalone research compound and as part of CagriSema, the combination of cagrilintide and semaglutide being developed by Novo Nordisk. As of 2026, cagrilintide monotherapy remains under clinical development rather than being treated as an established research-to-market endpoint.
For a research website, it is important to separate this scientific background from medical claims. The research material described on this page is not a medicine or dietary supplement.
Cagrilintide Peptide 5mg & 10mg Product Specifications
| Specification | Details |
|---|---|
| Product | Cagrilintide |
| Available Sizes | 5mg and 10mg |
| Alternative Names | AM833, NN9838 |
| Compound Type | Long-acting lipidated amylin analogue |
| Peptide Family | Amylin analogue |
| CAS Number | 1415456-99-3 |
| Molecular Formula | C₁₉₄H₃₁₂N₅₄O₅₉S₂ |
| Molecular Weight | Approximately 4,409 g/mol |
| Physical Form | Lyophilised powder |
| Research Area | Amylin, metabolic and receptor-signalling research |
| Intended Use | Laboratory research only |
Public chemical databases report the formula C₁₉₄H₃₁₂N₅₄O₅₉S₂ and molecular weight of approximately 4,409 g/mol. The exact analytical characteristics of the supplied material should always be confirmed against its current batch-specific documentation.
Buy Cagrilintide 5mg Ireland
The 5mg Cagrilintide option provides a defined research quantity for laboratories investigating amylin-related biology, peptide chemistry and metabolic signalling.
A 5mg presentation can be useful for researchers who require a smaller quantity of research material or who are evaluating the compound within a controlled laboratory research programme.
The product identity, purity and batch information should always be verified using the relevant Certificate of Analysis.
Buy Cagrilintide 10mg Ireland
The 10mg Cagrilintide option provides twice the labelled quantity of the 5mg presentation.
It is intended for researchers whose laboratory purchasing requirements call for a larger quantity of the same research compound.
Both the 5mg and 10mg options represent Cagrilintide and differ primarily in the quantity supplied.
Cagrilintide Peptide Research Applications
Cagrilintide has attracted significant scientific interest because of its activity as a long-acting amylin analogue.
Research areas associated with cagrilintide include:
- Amylin receptor biology
- Peptide-receptor interactions
- Metabolic signalling
- Appetite-related signalling research
- Energy-balance research
- Body-weight regulation research
- Peptide pharmacology
- Analytical peptide research
- Metabolic disease research
- Combination peptide research
Research programmes have examined cagrilintide both as a standalone amylin analogue and in combination with semaglutide.
Cagrilintide and Amylin Research
Amylin is a peptide hormone associated with pancreatic beta cells and is involved in physiological processes related to nutrient and energy regulation.
Cagrilintide was designed as a long-acting amylin analogue, making it useful in research investigating amylin receptor pathways and related biological responses.
Researchers can therefore use cagrilintide as a defined experimental compound when investigating:
Amylin Receptor Signalling
Cagrilintide provides a research tool for examining biological pathways associated with amylin receptor activity.
Metabolic Research
Researchers can study amylin-related mechanisms within broader metabolic research programmes.
Peptide Pharmacology
Its modified structure and long-acting characteristics make cagrilintide relevant to peptide pharmacology and structure-function research.
Combination Peptide Research
Cagrilintide has also been investigated alongside semaglutide as part of CagriSema research.
Cagrilintide and CagriSema
Cagrilintide should not be confused with CagriSema.
Cagrilintide is the amylin analogue itself.
CagriSema is a combination of cagrilintide and semaglutide.
Novo Nordisk has reported phase 3 research involving both cagrilintide and CagriSema. In its 2025 annual report, Novo Nordisk reported that cagrilintide was being advanced as a monotherapy in the RENEW phase 3 programme, while CagriSema combines cagrilintide with semaglutide.
For product identification, these should always be treated as separate materials.
Cagrilintide Structure
Cagrilintide is a modified peptide based on amylin biology.
Public chemical databases list the cagrilintide structure as:
X-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂
where X represents the N-terminal lipid modification. The molecule also contains a disulfide bridge within the peptide structure.
The lipid modification is an important part of cagrilintide’s molecular design and should be considered when distinguishing it from conventional non-lipidated peptides.
Cagrilintide Quality and Testing
Quality documentation is an important part of purchasing research-grade cagrilintide.
Researchers should look for documentation identifying:
- Product name
- Batch or lot number
- Reported purity
- HPLC testing
- Mass-spectrometry or LC-MS testing where available
- Net quantity
- Testing date
- Laboratory or testing provider
Current research suppliers commonly advertise HPLC testing and batch-specific COAs for cagrilintide.
The actual batch-specific COA should always take priority over general website specifications.
Cagrilintide Certificate of Analysis
A Certificate of Analysis (COA) helps researchers verify the analytical characteristics of a particular cagrilintide batch.
A useful COA may contain:
- Batch number
- Product identification
- Purity result
- HPLC chromatogram
- Mass-spectrometry result
- Quantity or assay information
- Testing date
- Laboratory information
Researchers should make sure that the lot number printed on the product corresponds to the lot number shown on the COA.
Cagrilintide 5mg vs 10mg
Both product options contain the same research compound.
| Feature | Cagrilintide 5mg | Cagrilintide 10mg |
|---|---|---|
| Compound | Cagrilintide | Cagrilintide |
| Type | Long-acting amylin analogue | Long-acting amylin analogue |
| Quantity | 5mg | 10mg |
| Research use | Yes | Yes |
| Product form | Lyophilised | Lyophilised |
| Batch documentation | Applicable | Applicable |
The primary difference between the two options is the labelled quantity supplied.
Cagrilintide Peptides Ireland
Researchers looking to buy Cagrilintide in Ireland can choose between the 5mg and 10mg product options according to their laboratory purchasing requirements.
Research Peptides Ireland focuses on clearly identified research materials and provides product information intended to help researchers assess the compound before purchase.
Irish customers should review the product information, quality documentation and applicable requirements before ordering.
Customers outside Ireland should independently check the import, possession and research-use requirements that apply in their destination country.
Cagrilintide Storage
Cagrilintide is commonly supplied as a lyophilised powder.
Published research-product specifications commonly recommend cold storage, with some suppliers specifying approximately −20°C and protection from light.
Storage requirements can vary according to the formulation, packaging and specific batch. Researchers should therefore follow the storage instructions supplied with the actual product.
Research Use Only
Cagrilintide 5mg and 10mg are supplied strictly for laboratory and scientific research.
They are not intended for:
- Human consumption
- Self-administration
- Veterinary use
- Medical treatment
- Disease diagnosis
- Disease prevention
- Dietary supplementation
- Unsupervised weight-management use
Research compounds should only be handled by appropriately qualified personnel in suitable laboratory environments and in accordance with applicable safety procedures, institutional policies and regulations.
Related Research Products
Researchers investigating metabolic and peptide-related research can also explore our AOD-9604 product, available in 5mg and 10mg options. AOD-9604 is a different synthetic peptide that has been investigated in research involving lipid metabolism and peptide biology.
You can also explore our broader research peptides available in Ireland catalogue to discover additional research-grade peptide products.
Buy Cagrilintide Peptide 5mg & 10mg Ireland
If you are looking to buy Cagrilintide Peptide in Ireland, Research Peptides Ireland offers this research compound in 5mg and 10mg options.
Cagrilintide is a long-acting, lipidated amylin analogue that has been extensively investigated in amylin, metabolic and peptide-receptor research. It has also been studied as a component of CagriSema, the combination of cagrilintide and semaglutide.
Before purchasing, researchers should review the product identity, quantity, analytical documentation, storage requirements and applicable legal or institutional requirements.
Cagrilintide is supplied for research use only and should not be represented as a human medicine, supplement or treatment.
Frequently Asked Questions
What is Cagrilintide?
Cagrilintide is a long-acting, lipidated analogue of the peptide hormone amylin. It has been investigated in research involving amylin receptor signalling, metabolism and energy regulation.
What sizes of Cagrilintide are available?
This product is available in 5mg and 10mg options.
Is Cagrilintide a peptide?
Yes. Cagrilintide is a modified peptide and a long-acting amylin analogue. Its structure includes a lipid modification that distinguishes it from conventional unmodified peptides.
What is Cagrilintide also called?
Cagrilintide has been associated with development codes including AM833 and NN9838.
What is the CAS number for Cagrilintide?
The commonly reported CAS number is 1415456-99-3.
What is the molecular weight of Cagrilintide?
Public chemical databases report a molecular weight of approximately 4,409 g/mol.
What is Cagrilintide studied for?
Cagrilintide is studied in research involving amylin receptor biology, metabolic signalling, peptide pharmacology, energy regulation and related research areas.
Is Cagrilintide the same as CagriSema?
No. Cagrilintide is one component of CagriSema. CagriSema combines cagrilintide with semaglutide.
Does Cagrilintide have clinical research?
Yes. Cagrilintide has been studied in clinical research programmes, including phase 3 research. Novo Nordisk reported that cagrilintide monotherapy entered its RENEW phase 3 programme following phase 3 data.
Does Cagrilintide come with a COA?
Research-grade cagrilintide can be supplied with batch-specific analytical documentation. Researchers should verify the COA for the exact lot supplied rather than relying only on general product information.
Is Cagrilintide Peptide tested by HPLC?
HPLC is commonly used for purity testing of research-grade cagrilintide, and some suppliers also provide mass-spectrometry or LC-MS information.
How should Cagrilintide Peptide be stored?
Published research-product specifications commonly recommend cold storage, often around −20°C, with protection from light. Always follow the storage instructions provided for the specific batch.
Is Cagrilintide Peptide for human use?
The research product described on this page is intended strictly for laboratory research and is not intended for human or veterinary use.
Can I buy Cagrilintide Peptide in Ireland?
Cagrilintide can be offered as a research-grade peptide in Ireland, subject to product availability and applicable laws and regulations. Customers should verify that their intended purchase and research use comply with all relevant requirements.
There are no reviews yet.