Buy IGF-1 LR3 1mg Ireland

Buy IGF-1 LR3 1mg in Ireland as a research-grade insulin-like growth factor analogue for laboratory and scientific research. IGF-1 LR3, also known as Long R3 IGF-1, is an 83-amino-acid modified analogue of human IGF-1. It is designed with a 13-amino-acid N-terminal extension and an arginine substitution at position 3, making it an important research material for studying IGF-1 receptor signalling, growth-factor biology, cellular signalling and related molecular pathways.

What Is IGF-1 LR3?

IGF-1 LR3 stands for Long Arginine 3 Insulin-like Growth Factor-1. It is a modified analogue of native human IGF-1.

Native IGF-1 contains 70 amino acids, while IGF-1 LR3 contains 83 amino acids. The additional N-terminal sequence and the modification at position 3 alter its interaction with IGF-binding proteins, making IGF-1 LR3 a useful experimental molecule for research involving the IGF system.

The commonly reported IGF-1 LR3 sequence is:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

IGF-1 LR3 is widely used as a laboratory research protein in studies of growth-factor signalling and IGF-1 receptor biology.

IGF-1 LR3 1mg Product Details

What Does LR3 Mean?

The LR3 designation describes two important structural features of this IGF-1 analogue.

L = Long

The molecule contains a 13-amino-acid N-terminal extension compared with native human IGF-1.

R3 = Arginine at Position 3

An arginine residue is present at position 3 in place of the glutamic acid found in native IGF-1.

Together, these structural modifications change the molecule’s interaction with IGF-binding proteins and make it useful for controlled research into IGF-related signalling.

IGF-1 LR3 and IGF-1 Receptor Research

IGF-1 LR3 is studied in relation to the insulin-like growth factor 1 receptor (IGF-1R).

IGF-1R is a cell-surface receptor involved in several important signalling pathways. Laboratory research can use IGF-1 LR3 to investigate receptor activation and downstream cellular responses.

Research areas include:

• IGF-1 receptor biology
• Growth-factor signalling
• PI3K/Akt signalling
• MAPK/ERK signalling
• Cell proliferation research
• Cell differentiation research
• Protein-receptor interactions
• Cellular metabolism
• Molecular biology
• Growth-factor pathway studies

Research Applications of IGF-1 LR3

IGF-1R Signalling

IGF-1 LR3 can be used in experimental systems investigating interactions between IGF-related ligands and IGF-1 receptors.

PI3K/Akt Pathway Research

The IGF signalling system is associated with intracellular pathways including PI3K/Akt. Researchers can study these pathways using controlled cellular models.

MAPK/ERK Research

IGF-related signalling can also interact with MAPK/ERK pathways. IGF-1 LR3 can therefore be useful in laboratory studies examining growth-factor signalling networks.

Cell Biology

Researchers can investigate IGF-1-related signalling in cultured cells and other experimental models to understand cellular responses to growth-factor stimuli.

Protein Chemistry

As a defined 83-amino-acid protein, IGF-1 LR3 can also be studied in research involving protein structure, analytical characterization, stability and receptor interactions.

IGF-1 LR3 1mg for Laboratory Research

The 1mg IGF-1 LR3 format provides a defined research quantity for laboratories working with IGF-related experimental systems.

Potential laboratory research areas include:

• IGF-1 receptor studies
• Growth-factor research
• Cell culture research
• Molecular signalling
• Protein chemistry
• Receptor-ligand interaction studies
• Cellular proliferation models
• Cellular differentiation studies
• Signal-transduction research
• Comparative IGF research

The specific experimental application should be determined by the researcher’s laboratory protocol and study design.

IGF-1 LR3 Quality and Testing

Research-grade IGF-1 LR3 can be characterized using analytical techniques designed to verify identity, purity and physical properties.

Quality documentation may include:

• Certificate of Analysis (COA)
• HPLC purity testing
• Mass spectrometry
• SDS-PAGE analysis
• Molecular-weight confirmation
• Batch or lot number
• Appearance information
• Peptide or protein content
• Manufacturing information

HPLC can be used to assess chromatographic purity, while mass spectrometry can help confirm molecular identity.

IGF-1 LR3 Storage

IGF-1 LR3 is commonly supplied as a lyophilized powder.

For laboratory storage:

• Keep the material sealed in its original container.
• Protect it from light and moisture.
• Store the lyophilized material according to the product-specific storage requirements.
• Avoid unnecessary temperature fluctuations.
• Follow laboratory SOPs and the supplied product documentation.

A commonly specified storage condition for lyophilized IGF-1 LR3 is -20°C.

Buy IGF-1 LR3 1mg Ireland

If you are looking to buy IGF-1 LR3 1mg in Ireland, this product provides a defined research format for laboratories investigating IGF-1 receptor biology, growth-factor signalling and related cellular pathways.

Research Peptides Ireland provides research-oriented peptide and protein products with clear specifications and laboratory-focused product information.

Researchers interested in other peptide-based laboratory materials can also explore our Glutathione 1500mg research product, available in a defined 1500mg format.

Research-Use-Only IGF-1 LR3

IGF-1 LR3 is supplied for laboratory and scientific research purposes only.

This product is not presented for human consumption, self-administration, diagnosis or treatment. Researchers should follow appropriate laboratory safety procedures, institutional requirements and applicable regulations when working with research materials.

Order IGF-1 LR3 1mg Ireland

Our IGF-1 LR3 1mg Ireland product is designed for researchers seeking a defined Long R3 IGF-1 research material.

With its 83-amino-acid structure and modified IGF-1 sequence, IGF-1 LR3 provides researchers with a useful molecular tool for investigating IGF-1 receptor interactions, growth-factor signalling and related cellular biology.

Review the product specifications, available analytical documentation and storage information before ordering.

Frequently Asked Questions

What is IGF-1 LR3?

IGF-1 LR3, or Long R3 IGF-1, is a modified 83-amino-acid analogue of human insulin-like growth factor-1. It is used as a research material in studies involving IGF-1 receptor signalling and growth-factor biology.

How much IGF-1 LR3 is available?

This product is available in a 1mg research format.

What does Long R3 mean?

“Long” refers to the 13-amino-acid N-terminal extension, while “R3” refers to the arginine substitution at position 3.

How many amino acids does IGF-1 LR3 contain?

IGF-1 LR3 contains 83 amino-acid residues, compared with 70 amino acids in native human IGF-1.

What is the molecular weight of IGF-1 LR3?

IGF-1 LR3 has a molecular weight of approximately 9.1 kDa, with commonly reported values around 9,117 Da.

What is the CAS number for IGF-1 LR3?

The commonly reported CAS number for IGF-1 LR3 is 946870-92-4.

What is IGF-1 LR3 studied for?

IGF-1 LR3 is studied in areas including IGF-1 receptor biology, growth-factor signalling, PI3K/Akt and MAPK/ERK pathways, cellular research and protein-receptor interactions.

Is IGF-1 LR3  1mg a peptide?

Yes. IGF-1 LR3 is an 83-amino-acid peptide/protein analogue of human IGF-1.

Does IGF-1 LR3 1mg come with quality documentation?

Research-grade products may include documentation such as a Certificate of Analysis, HPLC results and mass-spectrometry data, depending on the batch.

Is IGF-1 LR3 intended for human use?

No. This product is supplied for laboratory research use only and is not intended for human consumption, self-administration, diagnosis or treatment.

Can I buy IGF-1 LR3 1mg in Ireland?

Yes. IGF-1 LR3 1mg Ireland is offered as a research-grade laboratory material for eligible scientific research applications.