Buy FOXO4-DRI 10mg Ireland

Buy FOXO4-DRI 10mg in Ireland for laboratory and scientific research. FOXO4-DRI is a synthetic D-retro-inverso peptide studied in cellular senescence, apoptosis, FOXO4-p53 signalling and ageing-related research. The peptide is designed around the FOXO4-p53 interaction and has been investigated primarily in cellular and animal research models. PubChem identifies FOXO4-DRI as a 46-residue peptide with the molecular formula C228H388N86O64 and a molecular weight of approximately 5358 g/mol.

What Is FOXO4-DRI?

FOXO4-DRI is a synthetic peptide developed as a research tool for studying the interaction between the FOXO4 transcription factor and p53, an important protein involved in cellular stress responses, cell-cycle regulation and apoptosis.

FOXO4-DRI is a D-retro-inverso peptide, meaning that it uses D-amino acids in a reversed sequence arrangement. This design is intended to reproduce important spatial features of a peptide while providing a different chemical configuration from the corresponding L-amino-acid sequence.

The commonly reported FOXO4-DRI sequence is:

LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG

The sequence contains 46 residues. PubChem records FOXO4-DRI under CAS 2460055-10-9 and PubChem CID 167312269.

FOXO4-DRI 10mg Product Specifications

PubChem reports the molecular formula and molecular weight for the FOXO4-DRI entry, while current research-peptide analytical listings describe the material as an all-D-amino-acid retro-inverso peptide.

FOXO4-DRI Peptide Sequence

The commonly reported single-letter sequence is:

LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG

FOXO4-DRI is notable because the sequence is constructed using D-amino acids in a retro-inverso configuration.

This structural design is important in peptide research because D-amino-acid peptides can have different stability and biological characteristics from conventional L-amino-acid peptides.

For researchers, the exact molecular form, sequence and stereochemistry are important when performing analytical characterization or comparing FOXO4-DRI with related FOXO4-derived peptides.

FOXO4-DRI and Cellular Senescence Research

One of the main research areas associated with FOXO4-DRI is cellular senescence.

Cellular senescence describes a state in which cells stop dividing while remaining metabolically active. Senescent cells can produce a range of signalling molecules and are therefore widely studied in ageing and disease biology.

Research involving FOXO4-DRI has investigated whether disrupting FOXO4-p53 interactions can influence the survival of senescent cells.

Potential laboratory research areas include:

• Cellular senescence
• Senescent-cell biology
• FOXO4-p53 interactions
• Apoptosis
• Cell-cycle regulation
• Molecular signalling
• Ageing-related cellular research
• Senescence-associated pathways
• Peptide-protein interactions

These applications describe areas of experimental research and do not establish FOXO4-DRI as an approved therapeutic treatment.

FOXO4 and p53 Research

FOXO4 and p53 are proteins involved in important cellular processes.

FOXO4 can interact with p53, and research has examined how this interaction contributes to the persistence of senescent cells.

FOXO4-DRI was developed as a molecular research tool intended to interfere with this interaction.

This makes the peptide useful for experimental studies investigating:

Protein-protein interactions

Researchers can study how FOXO4 and p53 interact at the molecular level.

Apoptosis research

Experimental models can investigate signalling pathways associated with programmed cell death.

Cellular senescence

FOXO4-DRI has been studied in models designed to investigate senescent-cell biology.

Molecular signalling

The peptide can be investigated alongside pathways involved in cellular stress, survival and apoptosis.

FOXO4-DRI 10mg as a Research Tool

FOXO4-DRI is particularly interesting as a research compound because it provides researchers with a defined molecular tool for investigating FOXO4-p53 biology.

Research can include:

• Peptide-protein binding studies
• Cellular senescence models
• Apoptosis assays
• Molecular biology
• Cell signalling research
• Protein interaction studies
• Ageing-related research
• Comparative peptide studies

FOXO4-DRI has been investigated in cellular and animal models rather than established as a human therapeutic product. Current research summaries also emphasize that human administration has not been established.

FOXO4-DRI and Senolytic Research

FOXO4-DRI is frequently described in research literature as a senolytic research peptide.

The term senolytic refers broadly to experimental approaches designed to investigate the selective removal or elimination of senescent cells.

FOXO4-DRI research has therefore attracted interest in areas such as:

• Cellular ageing
• Senescent-cell clearance
• Apoptotic signalling
• Tissue ageing models
• Fibrosis research
• Ageing-related molecular biology

However, research findings from cell and animal models should not be presented as established effects in humans.

FOXO4-DRI 10mg

The 10mg FOXO4-DRI format provides a defined quantity of the peptide for laboratory research.

A 10mg research format can be useful for laboratories conducting multiple analytical or experimental investigations where a larger quantity of peptide material is required.

The product contains FOXO4-DRI as a defined research peptide rather than a mixture of unrelated compounds.

FOXO4-DRI Molecular Characteristics

FOXO4-DRI has a molecular formula of:

C228H388N86O64

PubChem reports a calculated molecular weight of approximately:

5358 g/mol

The peptide is unusually large compared with short peptides such as Epithalon or DSIP because FOXO4-DRI contains 46 amino-acid residues and includes a highly charged sequence region.

Its distinctive molecular structure is one reason analytical characterization is important when working with this research peptide.

FOXO4-DRI Quality Testing

Quality documentation is an important part of laboratory research peptide selection.

Available product documentation may include:

• Product identification
• Batch or lot number
• Peptide quantity
• Purity
• HPLC analysis
• Mass spectrometry
• Molecular-weight confirmation
• Testing date
• Product specifications

HPLC can be used to evaluate chromatographic purity, while mass spectrometry can help confirm molecular mass.

Current FOXO4-DRI research-product testing examples report HPLC purity and ESI-MS molecular-weight analysis as part of batch verification.

FOXO4-DRI HPLC and Mass Spectrometry

For a large peptide such as FOXO4-DRI, analytical characterization is particularly useful.

HPLC

High-performance liquid chromatography can help researchers examine the purity profile and chromatographic characteristics of the peptide.

LC-MS / ESI-MS

Mass spectrometry can help determine whether the measured molecular mass corresponds with the expected FOXO4-DRI molecular identity.

Using multiple analytical methods provides researchers with useful information when characterizing a synthetic peptide.

Storage and Handling

FOXO4-DRI is commonly supplied as a lyophilized research peptide.

Researchers should store and handle the product according to the product documentation and established laboratory procedures.

Important considerations include:

• Appropriate temperature control
• Protection from moisture
• Protection from direct light
• Keeping the container sealed
• Minimizing unnecessary environmental exposure
• Following appropriate laboratory safety procedures

Specific storage requirements should follow the documentation supplied with the product.

Why Buy FOXO4-DRI 10mg in Ireland?

Buying FOXO4-DRI 10mg from an Ireland-focused research supplier gives laboratories convenient access to a defined research peptide format.

Research Peptides Ireland provides product information covering:

• FOXO4-DRI identity
• Molecular specifications
• Peptide sequence
• Research applications
• Available quantity
• Quality information
• Analytical testing
• Storage information

The 10mg format provides a clearly defined quantity for laboratory research.

FOXO4-DRI Ireland Delivery

FOXO4-DRI 10mg is available for customers in Ireland, subject to applicable laws and regulations.

Worldwide delivery may also be available where permitted by the destination country’s regulations concerning research peptides and laboratory materials.

Customers should ensure that research materials are permitted for their intended laboratory use and destination.

Buy FOXO4-DRI 10mg Ireland

If you are looking to buy FOXO4-DRI 10mg in Ireland, Research Peptides Ireland provides this synthetic research peptide in a defined 10mg format.

FOXO4-DRI is a 46-residue D-retro-inverso peptide studied in cellular senescence, FOXO4-p53 interaction, apoptosis and molecular signalling research. PubChem lists its molecular formula as C228H388N86O64 and molecular weight as approximately 5358 g/mol.

Researchers can review the product specifications, sequence and available quality documentation before ordering.

FOXO4-DRI 10mg — research-grade peptide for laboratory research.

Research Use Only

FOXO4-DRI 10mg is supplied strictly for laboratory and scientific research.

It is not marketed as a medicine, dietary supplement or consumer health product.

This product page does not provide instructions for human administration, dosing or treatment.

Frequently Asked Questions

What is FOXO4-DRI?

FOXO4-DRI is a synthetic D-retro-inverso peptide studied as a research tool for investigating FOXO4-p53 interactions, cellular senescence and apoptosis-related signalling.

What does DRI mean in FOXO4-DRI?

FOXO4-DRI refers to a D-retro-inverso peptide design, using D-amino acids in a reversed sequence arrangement.

What is the FOXO4-DRI sequence?

The commonly reported sequence is LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG.

How many amino acids are in FOXO4-DRI?

FOXO4-DRI contains 46 amino-acid residues.

What is the molecular weight of FOXO4-DRI?

PubChem reports a molecular weight of approximately 5358 g/mol.

What is the molecular formula of FOXO4-DRI?

The molecular formula is C228H388N86O64.

What is the CAS number for FOXO4-DRI?

The CAS number listed for FOXO4-DRI is 2460055-10-9.

What is FOXO4-DRI 10mg studied for?

FOXO4-DRI is studied in areas including cellular senescence, FOXO4-p53 interactions, apoptosis, molecular signalling and ageing-related cellular research.

Is FOXO4-DRI 10mg  a senolytic peptide?

FOXO4-DRI is commonly described as a senolytic research peptide because it has been investigated for its ability to interfere with molecular pathways involved in senescent-cell survival.

Is FOXO4-DRI 10mg  clinically approved?

FOXO4-DRI is a research compound and should not be presented as an approved human therapeutic. Current evidence is centered on laboratory and animal research.

What size of FOXO4-DRI is available?

This product is available in a 10mg research format.

Is FOXO4-DRI available in Ireland?

Yes. FOXO4-DRI 10mg is offered for laboratory research in Ireland, subject to applicable regulations.

Does FOXO4-DRI come with quality documentation?

Available product documentation may include batch information, purity testing, HPLC results and molecular-weight analysis.

Is FOXO4-DRI for human use?

No. FOXO4-DRI is supplied strictly for laboratory research use and is not intended for human use or self-administration.