Buy LL-37 5mg Ireland

Buy LL-37 5mg in Ireland as a research-grade synthetic peptide for laboratory and scientific research. LL-37 is a 37-amino-acid peptide derived from the human cathelicidin precursor hCAP-18 and is widely studied in research involving innate immune biology, peptide-membrane interactions, host-defense mechanisms, cellular signalling and inflammatory pathways. The 5mg format provides a defined quantity of lyophilized LL-37 for controlled laboratory research.

What Is LL-37?

LL-37 is a 37-amino-acid human cathelicidin peptide. It is the mature C-terminal peptide derived from the precursor protein human cathelicidin hCAP-18.

The LL-37 sequence is:

[LL-37, 37 aa]

LL-37 is a positively charged, amphipathic peptide that has become an important research model for investigating peptide-membrane interactions and innate immune signalling.

LL-37 5mg Product Details

LL-37 Peptide Structure

LL-37 contains 37 amino-acid residues and has a strongly cationic character. Its structure allows researchers to investigate interactions between peptides and biological membranes under controlled laboratory conditions.

The complete sequence is:

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Short sequence:

[LL-37, 37 aa]

LL-37 and Cathelicidin Research

LL-37 belongs to the cathelicidin family of host-defense peptides. It is particularly useful as a research model for studying how cationic peptides interact with membranes and participate in cellular signalling.

Laboratory research involving LL-37 includes:

• Innate immune signalling
• Peptide-membrane interactions
• Host-defense peptide biology
• Cellular signalling
• Inflammatory pathway research
• Epithelial biology
• Microbe-host interaction research
• Peptide structure-function studies
• Analytical peptide chemistry
• Molecular biology

Research Applications of LL-37

Antimicrobial Peptide Research

LL-37 is extensively studied as a model antimicrobial peptide. Researchers can investigate how its structure influences interactions with microbial membranes and lipid environments.

Innate Immune Research

LL-37 is associated with research into innate immune mechanisms and cellular signalling. Experimental models can be used to examine interactions between LL-37 and immune-related molecular pathways.

Peptide-Membrane Interaction Studies

The amphipathic and positively charged nature of LL-37 makes it useful for studying peptide interactions with lipid membranes.

Researchers can examine factors such as:

• Membrane composition
• Peptide binding
• Membrane permeability
• Peptide conformation
• Lipid-peptide interactions
• Structure-function relationships

Inflammatory Signalling Research

LL-37 is also investigated in experimental models involving inflammatory signalling and cellular responses.

Epithelial Biology

Research has examined LL-37 in relation to epithelial tissues and cellular responses, making it a useful molecular tool for studying host-environment interactions.

LL-37 5mg for Laboratory Research

The 5mg LL-37 format provides a defined quantity of synthetic peptide for laboratory research.

Potential research applications include:

• In-vitro peptide studies
• Membrane interaction experiments
• Antimicrobial peptide research
• Innate immune research
• Cellular signalling studies
• Epithelial biology
• Protein and peptide chemistry
• Peptide stability research
• Analytical characterization
• Structure-function studies

The specific experimental application should be determined by the researcher’s laboratory protocol and study design.

LL-37 Quality and Testing

Research-grade LL-37 can be evaluated using analytical methods designed to confirm peptide identity and purity.

Quality documentation may include:

• Certificate of Analysis (COA)
• HPLC purity analysis
• Mass spectrometry
• Molecular-weight confirmation
• Peptide identity testing
• Batch or lot number
• Appearance information
• Peptide content
• Manufacturing information

HPLC can be used to assess chromatographic purity, while mass spectrometry can help confirm the expected molecular identity.

LL-37 Storage

LL-37 is commonly supplied as a lyophilized powder.

For laboratory storage:

• Keep the peptide in its original labelled container.
• Protect the material from moisture and excessive light.
• Maintain appropriate storage conditions.
• Avoid unnecessary temperature fluctuations.
• Follow the storage requirements provided with the specific product.
• Use established laboratory procedures when handling research peptides.

A commonly specified storage condition for lyophilized LL-37 is -20°C for longer-term storage.

Buy LL-37 5mg Ireland

If you are looking to buy LL-37 5mg in Ireland, this product provides a defined research-grade peptide format for laboratories investigating cathelicidin biology, innate immune signalling, peptide-membrane interactions and cellular research.

Research Peptides Ireland provides research-oriented peptide products with clear specifications and laboratory-focused information.

Researchers interested in other peptide research materials can also explore our KPV 10mg product, a defined three-amino-acid peptide used in peptide and molecular research.

Research-Use-Only LL-37

LL-37 is supplied for laboratory and scientific research purposes only.

This product is not presented for human consumption, self-administration, diagnosis or treatment. Research findings involving LL-37 should be interpreted within the context of the specific experimental model and study design.

Researchers should follow appropriate laboratory safety procedures, institutional requirements and applicable regulations when working with research peptides.

Order LL-37 5mg Ireland

Our LL-37 5mg Ireland product is designed for researchers seeking a defined 37-amino-acid cathelicidin research peptide.

Its well-characterized sequence and molecular structure make LL-37 a useful laboratory material for investigating peptide-membrane interactions, innate immune biology, cellular signalling and peptide chemistry.

Review the product specifications, available analytical documentation and storage information before ordering.

Frequently Asked Questions

What is LL-37?

LL-37 is a 37-amino-acid human cathelicidin peptide derived from the C-terminal portion of the hCAP-18 precursor protein.

How much LL-37 is available?

This product is available in a 5mg research format.

What is the sequence of LL-37?

The LL-37 sequence is [LL-37, 37 aa]

How many amino acids does LL-37 contain?

LL-37 contains 37 amino-acid residues.

What is the molecular weight of LL-37?

LL-37 has a molecular weight of approximately 4493.3 g/mol.

What is the molecular formula of LL-37?

The commonly listed molecular formula is C₂₀₅H₃₄₀N₆₀O₅₃.

What is the CAS number for LL-37?

The commonly listed CAS number is 154947-66-7.

What is LL-37 studied for?

LL-37 is studied in areas including antimicrobial peptide research, innate immune signalling, peptide-membrane interactions, inflammatory pathways, epithelial biology and cellular signalling.

Is LL-37 5mg a peptide?

Yes. LL-37 is a synthetic 37-amino-acid peptide belonging to the cathelicidin family.

Does LL-37 come with quality documentation?

Research-grade LL-37 products may be supplied with documentation such as a Certificate of Analysis, HPLC results and mass-spectrometry information, depending on the batch.

Is LL-37 5mg intended for human use?

No. This product is supplied for laboratory research use only and is not intended for human consumption, self-administration, diagnosis or treatment.

Can I buy LL-37 5mg in Ireland?

Yes. LL-37 5mg Ireland is offered as a research-grade peptide format for eligible laboratory and scientific research applications.