Buy Sermorelin 5mg Ireland
Buy Sermorelin 5mg in Ireland for laboratory and scientific research. Sermorelin is a synthetic 29-amino-acid peptide corresponding to the N-terminal portion of human growth hormone-releasing hormone (GHRH). It is studied in research involving GHRH receptor signalling, peptide-receptor interactions, endocrine biology and growth-hormone-related cellular pathways.
Research Peptides Ireland supplies Sermorelin 5mg as a research-use-only peptide material, with product information covering its sequence, molecular characteristics, analytical testing and laboratory storage considerations.
What Is Sermorelin?
Sermorelin is a synthetic peptide corresponding to GHRH(1-29)-NHâ‚‚, the amidated 29-amino-acid segment at the N-terminus of human growth hormone-releasing hormone.
The peptide sequence is:
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NHâ‚‚
In abbreviated one-letter notation:
YADAIFTNSYRKVLGQLSARKLLQDIMSR
Sermorelin is therefore closely associated with GHRH research and is useful as a defined peptide model for studying signalling through the growth hormone-releasing hormone receptor.
Sermorelin 5mg Product Information
| Product | Sermorelin |
|---|---|
| Quantity | 5mg |
| Peptide type | Synthetic 29-amino-acid peptide |
| Common description | GHRH(1-29)-NHâ‚‚ |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR |
| CAS number | 86168-78-7 |
| Molecular formula | C149H246N44O42S |
| Molecular weight | Approximately 3357.9 g/mol |
| Peptide length | 29 amino acids |
| Typical research form | Lyophilized peptide |
| Intended use | Laboratory research |
| Human use | Not intended for human use |
Sermorelin acetate is a salt form of the peptide and has different molecular characteristics from the free peptide. Researchers should therefore distinguish between the peptide itself and an acetate or hydrated salt when comparing analytical specifications.
Sermorelin Peptide Sequence
The complete Sermorelin sequence is:
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NHâ‚‚
The peptide contains 29 amino acids and represents the N-terminal GHRH(1-29) region in amidated form.
The sequence can be divided into several regions containing amino acids involved in the structure and receptor interaction of the GHRH peptide.
For research purposes, the complete sequence is an important identity marker when comparing Sermorelin products.
Sermorelin Molecular Specifications
Commonly reported Sermorelin specifications include:
- CAS: 86168-78-7
- Molecular formula: C149H246N44O42S
- Molecular weight: approximately 3357.9 g/mol
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR
- Peptide length: 29 amino acids
- Peptide designation: GHRH(1-29)-NHâ‚‚
- Common research form: lyophilized material
Sermorelin acetate is associated with a different CAS identifier and molecular mass because the acetate counterion is included.
How Is Sermorelin Studied?
Sermorelin is primarily studied as a GHRH-related research peptide.
Laboratory research can investigate:
- GHRH receptor signalling
- peptide-receptor interactions
- growth-hormone-related signalling pathways
- endocrine cell biology
- pituitary signalling research
- peptide structure-function relationships
- synthetic peptide chemistry
- receptor activation studies
- hormone signalling pathways
- molecular interactions involving GHRH
Because Sermorelin is a defined GHRH fragment, it provides a useful research model for investigating the relationship between peptide structure and receptor-mediated signalling.
Sermorelin and GHRH
Growth hormone-releasing hormone (GHRH) is a peptide hormone involved in the regulation of growth hormone secretion.
Sermorelin corresponds to the biologically active N-terminal portion of human GHRH, containing 29 amino acids and ending in an amidated arginine.
This makes Sermorelin particularly relevant to studies involving the GHRH receptor (GHRHR).
Researchers can use GHRH-related peptides to investigate:
- receptor binding
- signal transduction
- peptide conformation
- receptor selectivity
- cellular signalling
- endocrine pathway regulation
Sermorelin vs GHRH
Sermorelin and full-length human GHRH are related but are not the same molecule.
| Feature | Sermorelin | Human GHRH |
|---|---|---|
| Peptide length | 29 amino acids | 44 amino acids |
| Structure | GHRH(1-29)-NHâ‚‚ | Full-length GHRH |
| Research focus | GHRH receptor signalling | GHRH biology and signalling |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR | Longer sequence |
| Molecular size | Approximately 3.36 kDa | Larger peptide |
| C-terminal modification | Amidated | Native GHRH structure |
This distinction is useful when selecting a specific peptide for laboratory research.
Why Choose Sermorelin 5mg for Research?
A 5mg Sermorelin format provides a defined quantity of a specialised GHRH-related peptide.
Researchers may select Sermorelin 5mg for:
- peptide-receptor studies
- GHRH receptor research
- endocrine signalling investigations
- synthetic peptide research
- molecular biology experiments
- peptide structure-function studies
- analytical peptide research
- comparative GHRH research
The appropriate research quantity depends on the laboratory’s experimental design and analytical requirements.
Sermorelin Quality and Analytical Testing
Specialised peptides such as Sermorelin benefit from clear analytical documentation.
HPLC Testing
High-performance liquid chromatography can be used to assess chromatographic purity and help characterise the peptide preparation.
Mass Spectrometry
Mass spectrometry can help confirm molecular identity by comparing the measured mass with the expected molecular mass.
Certificate of Analysis
A batch-specific Certificate of Analysis can provide information about the tested material, including available purity and analytical results.
Batch Information
Researchers may also review:
- batch or lot number
- peptide identity
- peptide sequence
- molecular weight
- purity result
- analytical method
- testing date
This information can help maintain accurate laboratory records.
Sermorelin Storage
Sermorelin is commonly supplied as a lyophilized research peptide.
Storage should follow the conditions supplied with the specific product.
General laboratory considerations include:
- Keep the peptide protected from moisture.
- Protect the container from excessive heat and light.
- Keep the original packaging properly sealed.
- Avoid unnecessary temperature fluctuations.
- Follow the supplied storage specifications.
- Handle the material using appropriate laboratory procedures.
Storage requirements may vary according to formulation and packaging.
Buy Sermorelin 5mg Ireland Online
If you are searching for Sermorelin 5mg Ireland, Research Peptides Ireland provides specialised research peptides for laboratory and scientific applications.
The 5mg Sermorelin format is intended for researchers investigating GHRH biology, peptide-receptor interactions, endocrine signalling and synthetic peptide chemistry.
Researchers interested in other peptide signalling materials can also explore Semax 5mg, which is a different synthetic peptide studied in neuropeptide and receptor-signalling research.
Research Use Only
Sermorelin 5mg is supplied for laboratory and scientific research only.
It is not presented as a dietary supplement or general consumer product. This page does not provide human dosing, administration or treatment instructions.
Researchers should follow appropriate laboratory safety procedures, institutional requirements and applicable regulations when handling synthetic peptide materials.
Frequently Asked Questions
What is Sermorelin?
Sermorelin is a synthetic 29-amino-acid peptide corresponding to GHRH(1-29)-NHâ‚‚. It is studied in GHRH receptor signalling and related peptide research.
What is Sermorelin 5mg?
Sermorelin 5mg is a research product containing a stated quantity of 5mg of Sermorelin peptide, commonly supplied as a lyophilized material.
What is the Sermorelin peptide sequence?
The Sermorelin sequence is:
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NHâ‚‚
How many amino acids are in Sermorelin?
Sermorelin contains 29 amino acids.
What is the molecular weight of Sermorelin?
The commonly reported molecular weight of the Sermorelin free peptide is approximately 3357.9 g/mol.
What is the molecular formula of Sermorelin?
The commonly reported molecular formula is C149H246N44O42S.
What is the CAS number for Sermorelin?
The commonly reported CAS number for Sermorelin is 86168-78-7. Sermorelin acetate has a separate CAS identifier.
Is Sermorelin the same as GHRH?
No. Sermorelin is a 29-amino-acid GHRH(1-29)-NHâ‚‚ fragment, while naturally occurring human GHRH is a longer 44-amino-acid peptide.
What is Sermorelin researched for?
Sermorelin is studied in areas including GHRH receptor biology, peptide-receptor interactions, endocrine signalling, peptide chemistry and growth-hormone-related cellular research.
What analytical tests are useful for Sermorelin?
Researchers may look for HPLC purity testing, mass-spectrometry identity confirmation, batch information and a corresponding Certificate of Analysis.
Is Sermorelin intended for human use?
No. The Sermorelin product listed by Research Peptides Ireland is presented for laboratory research use only and is not intended for human administration.
Can I buy Sermorelin 5mg in Ireland?
Yes. Sermorelin 5mg Ireland is available as a research-oriented peptide product through the Research Peptides Ireland catalogue, subject to applicable purchasing and shipping requirements.
There are no reviews yet.