Your cart is empty.
Shop
Great things are on the horizon
Something big is brewing! Our store is in the works and will be launching soon!
Glow Blend (BPC-157 + TB-500 + GHK-Cu)
70mgThe GLOW Peptide Blend is a widely studied research blend that combines GHK-Cu, BPC-157, and TB-500 in one formula.
€69.99GHK-Cu 100mg
Specification Details Product GHK-Cu Common name Copper Tripeptide-1 Alternative name Prezatide Copper Quantity 100mg Peptide Gly-His-Lys Peptide length 3 amino acids Metal Copper(II) Complex GHK-Cu CAS number 89030-95-5 Molecular formula C14H22CuN6O4 Molecular mass Approximately 402 g/mol Product type Copper-containing research peptide Physical form Lyophilized research material Intended use Laboratory research only €69.99GHK-Cu 50mg
Specification Details Product GHK-Cu Common name Copper tripeptide Alternative name Copper tripeptide-1 Other name Prezatide copper Quantity 50mg Peptide Gly-His-Lys Peptide length 3 amino acids Metal Copper(II) Complex 1:1 GHK complex Molecular formula C14H22CuN6O4 Molecular weight Approximately 401.91 g/mol Product type Research peptide / metallopeptide Intended use Laboratory research only €39.99FOXO4-DRI 10mg
Specification Details Product FOXO4-DRI Quantity 10mg Peptide type D-retro-inverso research peptide Sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG Sequence length 46 residues Molecular formula C228H388N86O64 Molecular weight Approximately 5358 g/mol CAS number 2460055-10-9 PubChem CID 167312269 Physical form Lyophilized research peptide Research area Cellular senescence and FOXO4-p53 biology Intended use Laboratory research only €139.99Epithalon
Specification Details Product name Epithalon Peptide Alternative names Epitalon, Epithalone Peptide type Synthetic tetrapeptide Sequence Ala-Glu-Asp-Gly (AEDG) Amino acids 4 Molecular formula C14H22N4O9 Molecular weight 390.35 g/mol CAS identifiers 64082-79-7; 307297-39-8 Available quantities 10ng and 50mg Product category Research peptide Intended use Laboratory research only €29.99DSIP
Specification Details Product name DSIP Peptide Full name Delta Sleep-Inducing Peptide Alternative name Emideltide Peptide type Nonapeptide Sequence WAGGDASGE Amino acids 9 Molecular formula C35H48N10O15 Molecular weight 848.8 g/mol CAS number 62568-57-4 Available sizes 5mg and 10mg Product category Research peptide Intended use Laboratory research only €24.99