Buy VIP 10mg Ireland

Buy VIP 10mg in Ireland for laboratory and scientific research. VIP, short for Vasoactive Intestinal Peptide, is a naturally occurring 28-amino-acid neuropeptide that can also be produced synthetically for research. It is studied in receptor biology, cellular signalling, neuroscience, gastrointestinal biology and immunology-related laboratory research. The 10mg format provides a defined quantity of VIP for controlled scientific investigations.

Research Peptides Ireland supplies VIP 10mg as a research-use-only peptide material, with product information covering its sequence, molecular identity, receptor research and analytical characteristics.

What Is VIP Peptide?

VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid peptide originally identified in gastrointestinal tissue but subsequently found throughout several biological systems.

Despite its name, VIP research is not limited to the intestine. The peptide is associated with signalling in the:

• nervous system
• gastrointestinal system
• immune system
• cardiovascular system
• respiratory system
• endocrine system

VIP produces its biological signalling primarily through two G-protein-coupled receptors known as VPAC1 (VIPR1) and VPAC2 (VIPR2).

This makes VIP an important research peptide for laboratories investigating peptide-receptor interactions and GPCR signalling.

VIP 10mg Product Information

The molecular information above describes the commonly referenced human VIP peptide. Salt or counterion forms can produce differences in the total molecular mass of a supplied preparation.

VIP Peptide Sequence

Human Vasoactive Intestinal Peptide contains 28 amino acids.

Its sequence is:

His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂

The abbreviated sequence is:

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂

The C-terminal amide is an important structural characteristic of biologically relevant VIP.

Researchers can use the sequence, molecular mass and analytical data together when confirming peptide identity.

VIP Molecular Specifications

Commonly reported specifications for human VIP include:

• Full name: Vasoactive Intestinal Peptide
• Abbreviation: VIP
• CAS: 40077-57-4
• Peptide length: 28 amino acids
• Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
• Molecular formula: C147H237N43O43S
• Molecular weight: approximately 3325.8 g/mol
• C-terminal modification: amidated
• Research receptors: VPAC1 and VPAC2
• Common research form: lyophilized peptide

These characteristics provide useful reference points for analytical identification and laboratory inventory.

How Is VIP Studied?

VIP has a broad range of research applications because VIP-related signalling occurs in multiple biological systems.

Laboratory research can investigate:

• VPAC1 receptor signalling
• VPAC2 receptor signalling
• GPCR biology
• neuropeptide signalling
• gastrointestinal biology
• immune-cell signalling
• smooth-muscle biology
• vascular signalling
• respiratory biology
• circadian signalling
• peptide-receptor interactions
• intracellular signalling pathways
• peptide structure-function relationships

Research applications depend on the experimental model and specific scientific question.

VIP and VPAC Receptor Research

Two major receptors associated with VIP are:

VPAC1 (VIPR1) and VPAC2 (VIPR2).

Both belong to the class B family of G-protein-coupled receptors.

VIP binding can be investigated in experimental models to understand receptor activation and downstream cellular signalling.

Research may examine:

• ligand-receptor binding
• receptor selectivity
• GPCR activation
• intracellular cyclic AMP signalling
• downstream protein kinase pathways
• receptor expression
• cellular responses
• receptor desensitisation

This makes VIP useful for laboratories investigating class B GPCR biology.

VIP and PACAP Research

VIP belongs to the same peptide family as PACAP, or Pituitary Adenylate Cyclase-Activating Polypeptide.

These peptides share structural similarities and can interact with related receptors.

Comparing VIP and PACAP can help researchers study receptor selectivity and peptide structure-function relationships.

VIP and Cellular Signalling Research

Activation of VIP receptors is commonly associated with adenylyl cyclase and cyclic AMP (cAMP) signalling.

This provides several possible areas for controlled laboratory investigation, including:

• cAMP production
• GPCR signalling
• protein kinase A-related pathways
• transcriptional responses
• cellular communication
• receptor trafficking
• second-messenger signalling

Researchers can therefore use VIP as a defined peptide ligand in appropriate receptor and cellular models.

VIP in Neuroscience Research

VIP is also classified as a neuropeptide.

It is present in different neuronal populations and has been studied in relation to neuronal communication and circadian biology.

Experimental research can investigate:

• neuronal peptide signalling
• neuropeptide receptor biology
• circadian signalling
• cellular communication
• neurotransmitter interactions
• hypothalamic signalling
• neuronal GPCR pathways

VIP-related signalling is therefore relevant to both molecular and systems-level neuroscience research.

VIP in Immunology Research

VIP and its receptors have also attracted attention in experimental immunology.

Research models can examine VIP-related signalling in:

• macrophages
• dendritic cells
• T-cell-related systems
• cytokine pathways
• inflammatory signalling
• immune-cell communication

These are research areas rather than claims that VIP 10mg is intended to prevent or treat disease.

Why Choose VIP 10mg for Research?

A 10mg VIP peptide format provides a defined quantity of a specialised 28-amino-acid research peptide.

Researchers may select VIP 10mg for:

• VPAC1 receptor studies
• VPAC2 receptor studies
• GPCR research
• neuropeptide research
• gastrointestinal biology
• cellular signalling
• immunology research
• peptide chemistry
• structure-function studies
• analytical peptide investigations

The appropriate quantity depends on the experimental design and laboratory requirements.

VIP Quality and Analytical Testing

Clear analytical information is important when purchasing research peptides.

HPLC Testing

High-performance liquid chromatography can be used to evaluate chromatographic purity and characterise the peptide preparation.

Mass Spectrometry

Mass spectrometry can help confirm molecular identity by comparing measured molecular mass with the expected mass of VIP.

Certificate of Analysis

A batch-specific Certificate of Analysis can provide information about the tested material, including available purity and identity results.

Batch Information

Useful documentation can include:

• product identity
• peptide sequence
• batch or lot number
• molecular weight
• purity result
• analytical method
• testing date
• counterion or salt information

These details help laboratories maintain accurate records for research materials.

VIP 10mg Storage

VIP is commonly supplied as a lyophilized peptide for laboratory research.

Storage should follow the conditions specified for the particular product.

General laboratory considerations include:

• Protect the peptide from moisture.
• Keep the container properly sealed.
• Protect it from excessive heat and direct light.
• Avoid unnecessary temperature fluctuations.
• Follow product-specific storage instructions.
• Handle the peptide using appropriate laboratory procedures.

Buy VIP 10mg Ireland Online

If you are searching for VIP 10mg Ireland, Research Peptides Ireland provides specialised research peptides for laboratory and scientific applications.

The 10mg VIP format is intended for researchers investigating VPAC receptor biology, GPCR signalling, neuropeptide pathways and related molecular processes.

Researchers investigating other signalling and immunology-related peptides can also explore Thymosin Alpha-1 5mg, a distinct 28-amino-acid peptide associated with immune-cell and cellular-signalling research.

Research Use Only

VIP 10mg is supplied for laboratory and scientific research only.

It is not presented as a dietary supplement or general consumer product. This page does not provide human dosing, administration or treatment instructions.

Researchers should follow appropriate laboratory safety procedures, institutional requirements and applicable regulations when handling peptide research materials.

Frequently Asked Questions

What is VIP peptide?

VIP stands for Vasoactive Intestinal Peptide, a 28-amino-acid neuropeptide studied in receptor biology, neuroscience, gastrointestinal research, cellular signalling and immunology.

What is VIP 10mg?

VIP 10mg is a research product containing a stated quantity of 10mg of Vasoactive Intestinal Peptide, typically supplied as a lyophilized research material.

What is the VIP peptide sequence?

The human VIP sequence is:

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂

How many amino acids are in VIP?

Human Vasoactive Intestinal Peptide contains 28 amino acids.

What is the molecular weight of VIP?

The commonly reported molecular weight of human VIP is approximately 3325.8 g/mol.

What is the molecular formula of VIP?

The commonly reported molecular formula is C147H237N43O43S.

What is the CAS number for VIP?

The commonly reported CAS number for human VIP is 40077-57-4.

Which receptors does VIP interact with?

VIP is principally studied in relation to VPAC1 (VIPR1) and VPAC2 (VIPR2) receptors.

Is VIP a neuropeptide?

Yes. VIP is a naturally occurring neuropeptide that participates in signalling across several biological systems.

Is VIP the same as PACAP?

No. VIP and PACAP are separate peptides, although they belong to the same broader peptide family and share activity at VPAC receptors.

What is VIP researched for?

VIP is studied in VPAC receptor signalling, GPCR biology, neuroscience, gastrointestinal biology, immune signalling, circadian research and peptide structure-function studies.

What analytical tests are useful for VIP?

Researchers may look for HPLC purity testing, mass-spectrometry identity confirmation, peptide sequence information, batch data and a corresponding Certificate of Analysis.

Is VIP 10mg intended for human use?

No. The VIP 10mg product listed by Research Peptides Ireland is presented for laboratory research use only and is not intended for human administration.

Can I buy VIP 10mg in Ireland?

Yes. VIP 10mg Ireland is available as a research-oriented peptide product through the Research Peptides Ireland catalogue, subject to applicable purchasing and shipping requirements.