Your cart is empty.
CJC-1295 with DAC 5mg
| Specification | Details |
|---|
| Product | CJC-1295 with DAC |
| Quantity | 5mg |
| Compound type | Synthetic GHRH analogue |
| DAC status | With Drug Affinity Complex |
| Research classification | Long-acting GHRH research peptide |
| Physical form | Lyophilised powder |
| Molecular weight | Approximately 3,647 Da for the DAC conjugate |
| CAS | 446262-90-4 is reported for the DAC conjugate |
| Intended use | Laboratory research only |
€39.99
CJC1295 NO DAC 5mg + BPC-157 5mg
| Specification | Details |
|---|
| Product | CJC1295 NO DAC + BPC-157 |
| CJC1295 quantity | 5mg |
| BPC-157 quantity | 5mg |
| Total peptide quantity | 10mg |
| Product type | Combined synthetic research peptides |
| CJC1295 classification | GHRH-related peptide analogue |
| BPC-157 classification | Synthetic 15-amino-acid peptide |
| Research applications | Peptide biology, receptor signalling and cellular research |
| Product form | Lyophilized research peptide |
| Intended use | Laboratory research only |
€39.99
CJC1295 NO DAC 5mg+Ipamorelin 5mg
| Specification | CJC1295 NO DAC | Ipamorelin |
|---|
| Quantity | 5mg | 5mg |
| Type | Synthetic peptide | Synthetic peptide |
| Research class | GHRH analogue | Ghrelin-mimetic peptide |
| Primary receptor | GHRH receptor | GHS-R1a |
| Molecular formula | C₁₅₂H₂₅₂N₄₄O₄₂ | C₃₈H₄₉N₉O₅ |
| Molecular weight | ~3,367.9 g/mol | ~711.9 g/mol |
| Sequence | Modified GHRH(1-29) analogue | Aib-His-D-2-Nal-D-Phe-Lys-NH₂ |
| Product format | Lyophilized research peptide | Lyophilized research peptide |
| Intended use | Laboratory research | Laboratory research |
€39.99
DSIP
| Specification | Details |
|---|
| Product name | DSIP Peptide |
| Full name | Delta Sleep-Inducing Peptide |
| Alternative name | Emideltide |
| Peptide type | Nonapeptide |
| Sequence | WAGGDASGE |
| Amino acids | 9 |
| Molecular formula | C35H48N10O15 |
| Molecular weight | 848.8 g/mol |
| CAS number | 62568-57-4 |
| Available sizes | 5mg and 10mg |
| Product category | Research peptide |
| Intended use | Laboratory research only |
€24.99
Epithalon
| Specification | Details |
|---|
| Product name | Epithalon Peptide |
| Alternative names | Epitalon, Epithalone |
| Peptide type | Synthetic tetrapeptide |
| Sequence | Ala-Glu-Asp-Gly (AEDG) |
| Amino acids | 4 |
| Molecular formula | C14H22N4O9 |
| Molecular weight | 390.35 g/mol |
| CAS identifiers | 64082-79-7; 307297-39-8 |
| Available quantities | 10ng and 50mg |
| Product category | Research peptide |
| Intended use | Laboratory research only |
€29.99
Follistatin 344 1mg
| Specification | Details |
|---|
| Product | Follistatin 344 |
| Abbreviation | FS344 |
| Protein Type | Secreted glycoprotein |
| Protein Length | 344 amino acids |
| Available Size | 1mg |
| Research Area | Activin and TGF-β superfamily biology |
| Primary Research Interest | Activin and ligand-binding studies |
€39.99
FOXO4-DRI 10mg
| Specification | Details |
|---|
| Product | FOXO4-DRI |
| Quantity | 10mg |
| Peptide type | D-retro-inverso research peptide |
| Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG |
| Sequence length | 46 residues |
| Molecular formula | C228H388N86O64 |
| Molecular weight | Approximately 5358 g/mol |
| CAS number | 2460055-10-9 |
| PubChem CID | 167312269 |
| Physical form | Lyophilized research peptide |
| Research area | Cellular senescence and FOXO4-p53 biology |
| Intended use | Laboratory research only |
€139.99
Fragment 176-191 5mg
| Specification | Details |
|---|
| Product | Fragment 176-191 |
| Alternative Name | hGH Fragment 176-191 |
| Peptide Type | Synthetic peptide fragment |
| Source Region | Human growth hormone residues 176–191 |
| Length | 16 amino acids |
| Sequence | Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe |
| Available Size | 5mg |
| Research Area | Peptide and molecular biology |
€29.99
FTPP 5mg
| Specification | Details |
|---|
| Product | FTPP |
| Available quantity | 5mg |
| Product type | Research compound / peptide |
| Physical form | Refer to current product specification |
| Purity | Refer to batch-specific documentation |
| Sequence | Confirm from current product documentation |
| CAS number | Confirm from current product documentation |
| Molecular weight | Confirm from current product documentation |
| Intended use | Laboratory and scientific research |
| Storage | Follow product label and documentation |
€39.99
GHK-Cu 100mg
| Specification | Details |
|---|
| Product | GHK-Cu |
| Common name | Copper Tripeptide-1 |
| Alternative name | Prezatide Copper |
| Quantity | 100mg |
| Peptide | Gly-His-Lys |
| Peptide length | 3 amino acids |
| Metal | Copper(II) |
| Complex | GHK-Cu |
| CAS number | 89030-95-5 |
| Molecular formula | C14H22CuN6O4 |
| Molecular mass | Approximately 402 g/mol |
| Product type | Copper-containing research peptide |
| Physical form | Lyophilized research material |
| Intended use | Laboratory research only |
€69.99
GHK-Cu 50mg
| Specification | Details |
|---|
| Product | GHK-Cu |
| Common name | Copper tripeptide |
| Alternative name | Copper tripeptide-1 |
| Other name | Prezatide copper |
| Quantity | 50mg |
| Peptide | Gly-His-Lys |
| Peptide length | 3 amino acids |
| Metal | Copper(II) |
| Complex | 1:1 GHK complex |
| Molecular formula | C14H22CuN6O4 |
| Molecular weight | Approximately 401.91 g/mol |
| Product type | Research peptide / metallopeptide |
| Intended use | Laboratory research only |
€39.99