Your cart is empty.
KPV 10mg
| Specification | Details |
|---|
| Product Name | KPV |
| Full Name | Lys-Pro-Val |
| Alternative Name | α-MSH(11-13) |
| Quantity | 10mg |
| Peptide Type | Synthetic tripeptide |
| Sequence | Lys-Pro-Val |
| One-Letter Sequence | KPV |
| Molecular Formula | C₁₆H₃₀N₄O₄ |
| Molecular Weight | Approximately 342.43 g/mol |
| CAS Number | 67727-97-3 |
| PubChem CID | 125672 |
| Form | Lyophilized powder |
| Research Format | 10mg |
| Intended Use | Laboratory research only |
€39.99
Lipo-C 10 mL
| Specification | Details |
|---|
| Product Name | Lipo-C |
| Quantity | 10ml |
| Product Type | Multi-component research solution |
| Common Description | Lipotropic / MIC research blend |
| Physical Form | Liquid aqueous solution |
| Typical Core Components | Methionine, Inositol, Choline |
| Additional Components | May vary by formulation |
| Molecular Formula | Multi-component formulation |
| Molecular Weight | Varies by individual component |
| Research Format | 10ml |
| Intended Use | Laboratory research only |
€39.99
LL-37 5mg
| Specification | Details |
|---|
| Product Name | LL-37 |
| Common Names | Cathelicidin LL-37, CAP18, hCAP-18-derived LL-37 |
| Quantity | 5mg |
| Peptide Type | Synthetic 37-amino-acid peptide |
| Sequence | [LL-37, 37 aa] |
| Sequence Length | 37 amino acids |
| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular Weight | Approximately 4493.3 g/mol |
| CAS Number | 154947-66-7 |
| Form | Lyophilized powder |
| Research Format | 5mg |
| Intended Use | Laboratory research only |
€39.98
Melanotan I (MT-1) 10mg
Analytical testing confirms greater than 99.8 % purity, assay content verified at 9.99 mg, molecular ion mass identified at 1646 Da and endotoxin levels measured at 0.002 EU/mg.
Supplied as a 10 mg lyophilized peptide with full COA traceability.
For research use only — not for human or veterinary use.
€54.99
Melanotan II (MT2) 10mg
Analytical testing confirms 99.5 % purity, assay content verified at 11.86 mg, molecular ion mass identified at 1024 Da and bacterial endotoxin measured at 0.016 EU/mg.
Supplied as a 10 mg lyophilized peptide with full COA traceability.
For research use only — not for human or veterinary use.
€49.99
MOTS-C
| Specification | Details |
|---|
| Product Name | MOTS-C |
| Full Name | Mitochondrial Open Reading Frame of the 12S rRNA-c |
| Peptide Type | Mitochondrial-derived peptide |
| Peptide Length | 16 amino acids |
| Available Sizes | 10mg, 20mg, 40mg |
| Sequence | MRWQEMGYIFYPRKLR |
| Molecular Formula | C₁₀₁H₁₅₂N₂₈O₂₂S₂ |
| Molecular Weight | Approximately 2174.6 g/mol |
| CAS Number | 1627580-64-6 |
| Physical Form | Lyophilized powder |
| Research Category | Mitochondrial / metabolic research |
| Intended Use | Laboratory research only |
€34.99
NAD+ 500mg
Analytical testing confirms greater than 99.8 % purity, assay content verified at 550 mg, molecular ion mass identified at 664 Da and endotoxin levels at 0.009 EU/mg.
Supplied as a 500 mg lyophilized NAD+ research compound with full COA traceability.
For research use only — not for human or veterinary use.
€59.99
PEG-MGF 2mg
Validated assay content: 1.94 mg with purity greater than 99.8 percent.
Endotoxin levels below 0.001 EU per mg. No detectable microbial growth or heavy metals.
€34.99
PT-141 10mg
Analytical testing confirms 99.7 % purity, assay content verified at 11.91 mg, molecular ion mass identified at 1025 Da and bacterial endotoxin measured at 0.029 EU/mg.
Supplied as a 10 mg lyophilized peptide with full COA traceability.
For research use only — not for human or veterinary use.
€34.99
Retatrutide
| Property | Retatrutide |
|---|
| Product name | Retatrutide |
| Development code | LY3437943 |
| Peptide type | Synthetic peptide |
| Research class | Triple receptor agonist |
| Primary receptors | GLP-1R, GIPR, GCGR |
| Available sizes | 10mg, 20mg, 30mg, 50mg, 60mg |
| Typical research form | Lyophilized peptide |
| Research areas | Metabolic signalling, receptor biology, peptide chemistry |
| Intended use | Laboratory research |
€59.99
Selank 10mg
Analytical testing confirms greater than 99.8 % purity, assay content verified at 12.29 mg, molecular ion mass identified at 751 Da and endotoxin levels measured at 0.013 EU/mg.
Supplied as a 10 mg lyophilized peptide with full COA traceability.
For research use only — not for human or veterinary use.
€39.99
Semaglutide
Semaglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist that has become one of the most extensively studied peptides in metabolic research.
€39.99